PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Cc07_g03360
Common NameGSCOC_T00039563001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Gentianales; Rubiaceae; Ixoroideae; Coffeeae; Coffea
Family ZF-HD
Protein Properties Length: 97aa    MW: 10331.4 Da    PI: 8.3844
Description ZF-HD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Cc07_g03360genomeCGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1ZF-HD_dimer103.71.2e-322582260
  ZF-HD_dimer  2 ekvrYkeClkNhAaslGghavDGCgEfmpsegeegtaaalkCaACgCHRnFHRreveee 60
                 ++vrY eC+kNhAa +Gg+avDGC+Efm+s geegt aal CaACgCHRnFHRreve+e
  Cc07_g03360 25 RNVRYGECQKNHAAGVGGYAVDGCREFMAS-GEEGTNAALSCAACGCHRNFHRREVETE 82
                 579**************************9.999*********************9876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD1257747.0E-31192IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
PfamPF047702.1E-302679IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
TIGRFAMsTIGR015667.7E-272879IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
PROSITE profilePS5152325.9952978IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
Sequence ? help Back to Top
Protein Sequence    Length: 97 aa     Download sequence    Send to blast
MKKRQVVVKR DESSKNATNS SFTVRNVRYG ECQKNHAAGV GGYAVDGCRE FMASGEEGTN  60
AALSCAACGC HRNFHRREVE TEAVCEGSSP SSLGRT*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007032530.15e-52Mini zinc finger 2 isoform 1
RefseqXP_007032531.15e-52Mini zinc finger 2 isoform 2, partial
SwissprotQ9LJW58e-42MIF2_ARATH; Mini zinc finger protein 2
TrEMBLA0A068U1654e-65A0A068U165_COFCA; Uncharacterized protein
STRINGVIT_14s0108g00810.t014e-51(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA11052486
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G28917.15e-43mini zinc finger 2